PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602081.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 348aa    MW: 39522.9 Da    PI: 7.9981
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602081.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.1e-5381371129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+++yLkkk++ +k+++ evi+evd++k+ePwdL++k+k     ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk +
  XP_009602081.1   8 VPPGFRFHPTDEELLHYYLKKKISFQKFDM-EVIREVDLNKIEPWDLQEKCKIgstPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCI 101
                     69****************************.99**************964444222455************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  XP_009602081.1 102 RN-SFKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 137
                     *9.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-605159IPR003441NAC domain
PROSITE profilePS5100558.098159IPR003441NAC domain
PfamPF023656.7E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MATSSGGVPP GFRFHPTDEE LLHYYLKKKI SFQKFDMEVI REVDLNKIEP WDLQEKCKIG  60
STPQNEWYFF SHKDRKYPTG SRTNRATNAG FWKATGRDKC IRNSFKKIGM RKTLVFYRGR  120
APHGQKTDWI MHEYRLEDAD DPQGNQSDDG WVICRVFMKK HLFKVGNEGS GAASSDQLNS  180
TSSHQSRAFN SQYLLQQQQQ QQQGGHSLNY SHIPLALPQY NSHLQLQPQN IIPNKPLGYH  240
DFSALPTSDH QAPLMVKQLM SSADSACSDQ NLPYNQQEVG SSCNHHQNLN EWGMIASSHG  300
QLGHGHGQED DNSAKTAGVR FDDANASSVN QINQLSLRGE MDFWGYTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-53816017166NO APICAL MERISTEM PROTEIN
1ut4_B8e-53816017166NO APICAL MERISTEM PROTEIN
1ut7_A8e-53816017166NO APICAL MERISTEM PROTEIN
1ut7_B8e-53816017166NO APICAL MERISTEM PROTEIN
3swm_A1e-52816020169NAC domain-containing protein 19
3swm_B1e-52816020169NAC domain-containing protein 19
3swm_C1e-52816020169NAC domain-containing protein 19
3swm_D1e-52816020169NAC domain-containing protein 19
3swp_A1e-52816020169NAC domain-containing protein 19
3swp_B1e-52816020169NAC domain-containing protein 19
3swp_C1e-52816020169NAC domain-containing protein 19
3swp_D1e-52816020169NAC domain-containing protein 19
4dul_A8e-53816017166NAC domain-containing protein 19
4dul_B8e-53816017166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602081.10.0PREDICTED: protein BEARSKIN1
SwissprotQ9SV871e-134BRN2_ARATH; Protein BEARSKIN2
TrEMBLF6GVX31e-152F6GVX3_VITVI; Putative uncharacterized protein
STRINGVIT_18s0089g01120.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-133NAC domain containing protein 70